ATP6V1A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP155212	Novus Biologicals NBP155212	100 μL

Description

ATP6V1A Polyclonal specifically detects ATP6V1A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ATP6V1A
• Classification: Polyclonal
• Host Species: Rabbit
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A
• Gene Symbols: ATP6V1A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: This product is specific to Subunit or Isoform: A.

• Applications: Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Accession No.: P38606
• Gene ID (Entrez): 523
• Immunogen: Synthetic peptides corresponding to ATP6V1A(ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A) The peptide sequence was selected from the N terminal of ATP6V1A. Peptide sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR.
• Primary or Secondary: Primary
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 68 kDa