ATP6V1H Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP185668

Catalog No. NBP185668

Description

ATP6V1H Polyclonal specifically detects ATP6V1H in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATP6V1H
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ATPase, H+ transporting, lysosomal 50/57kD, V1 subunit H, ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, CGI-11, MSTP042, NBP1, Nef-binding protein 1, Protein VMA13 homolog, SFD, SFDalpha, SFDbeta, vacuolar ATP synthase subunit H, vacuolar ATPase subunit H, vacuolar proton pump H subunit, Vacuolar proton pump subunit H, Vacuolar proton pump subunit SFD, V-ATPase 50/57 kDa subunits, V-ATPase H subunit, V-ATPase subunit H, VMA13, V-type proton ATPase subunit H
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51606
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ATP6V1H
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only