Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP8B2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ATP8B2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ATP8B2 Polyclonal specifically detects ATP8B2 in Human samples. It is validated for Western Blot.Specifications
| ATP8B2 | |
| Polyclonal | |
| Rabbit | |
| ATPase, class I, type 8B, member 2, ATPIDprobable phospholipid-transporting ATPase ID, DKFZp434M0219, EC 3.6.3, EC 3.6.3.1, KIAA1137ATPase class I type 8B member 2, phospholipid-transporting ATPase ID | |
| ATP8B2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 57198 | |
| Synthetic peptides corresponding to ATP8B2 (ATPase, class I, type 8B, member 2) The peptide sequence was selected from the N terminal of ATP8B2. Peptide sequence KTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title