ATPase Inhibitory Factor 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179284

Catalog No. NBP179284

Description

ATPase Inhibitory Factor 1 Polyclonal specifically detects ATPase Inhibitory Factor 1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ATPase Inhibitory Factor 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP synthase inhibitor protein, ATPase inhibitor protein, ATPase inhibitor, mitochondrial, ATPase inhibitory factor 1, ATPIIF(1), ATPIP, IF1, Inhibitor of F(1)F(o)-ATPase, IP, MGC1167, MGC8898
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Xenopus: 85%; Mouse: 85%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_057395
• Gene Symbols: ATP5IF1
• Immunogen: Synthetic peptide directed towards the N terminal of human ATPIF1. Peptide sequence GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 93974
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only