Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATPGD1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$382.00 - $646.00

Specifications

Antigen ATPGD1
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB436658
SDP
View Documents
Novus Biologicals
NBP23405025UL
25 μL
Each for $382.00
Only null left
Add to Cart
 
NBP234050
SDP
View Documents
Novus Biologicals
NBP234050
0.1 mL
Each for $646.00
Only null left
Add to Cart
 
Description

Description

ATPGD1 Polyclonal specifically detects ATPGD1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

ATPGD1
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
ATP-grasp domain-containing protein 1, carnosine synthase 1, EC 6.3.2.11, KIAA1394ATPGD1ATP-grasp domain containing 1
CARNS1
IgG
Affinity Purified
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Polyclonal
Rabbit
Human
A5YM72
57571
This antibody was developed against a recombinant protein corresponding to amino acids: LMEFVEGTEHDVDLVLFGGRLLAAFVSDNGPTRLPGFTETAACMPTGLAPEQEAQMVQAAFRCCLGCGLLDGVFNVELKLTGAGPRLIEINPRMGGFY
Primary
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Videos
SDS
Documents

Documents

Product Certifications

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.