Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Atrial Natriuretic Peptide/ANP Antibody [Janelia Fluor« 669], Novus Biologicals Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP335642JF669
Description
Atrial Natriuretic Peptide/ANP Polyclonal antibody specifically detects Atrial Natriuretic Peptide/ANP in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
Atrial Natriuretic Peptide/ANP | |
Polyclonal | |
50mM Sodium Borate | |
Rabbit | |
Affinity purified | |
RUO | |
4878 | |
Store at 4°C in the dark. | |
Purified |
ELISA, Western Blot | |
Janelia Fluor 669 | |
ANF, ANPatriopeptin, ATFB6, atrial natriuretic factor, Atrial natriuretic peptide, CDD-ANF, natriuretic peptide A, natriuretic peptide precursor A, PNDcardionatrin, prepronatriodilatin | |
Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human Atrial Natriuretic Peptide/ANP (NP_006154.1).,, Sequence:, LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN | |
0.1 mL | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction