ATRX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP255953	Novus Biologicals NBP255953	100 μL
NB394736	Novus Biologicals NBP25595325UL	25 μL

Description

ATRX Polyclonal specifically detects ATRX in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ATRX
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 546
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: alpha thalassemia/mental retardation syndrome X-linked, alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog), alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae), ATP-dependent helicase ATRX, ATR2, DNA dependent ATPase and helicase, EC 3.6.1, EC 3.6.4.12, helicase 2, X-linked, Juberg-Marsidi syndrome, MGC2094, MRXHF1, RAD54 homolog, RAD54L, SFM1, SHS, transcriptional regulator ATRX, XH2RAD54, X-linked helicase II, X-linked nuclear protein, XNPZNF-HX, Zinc finger helicase, Znf-HX
• Gene Symbols: ATRX
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only