ATXN7L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156311

Catalog No. NBP156311

Description

ATXN7L1 Polyclonal specifically detects ATXN7L1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ATXN7L1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ataxin 7-like 1, ataxin 7-like 4, ataxin-7-like protein 1, Ataxin-7-like protein 4, ATXN7L4, FLJ40255, FLJ58242, KIAA1218MGC10760, MGC33190
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 222255
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A4D0Q2
• Gene Symbols: ATXN7L1
• Immunogen: Synthetic peptides corresponding to ATXN7L1(ataxin 7-like 1) The peptide sequence was selected from the middle region of ATXN7L1. Peptide sequence KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Rabbit
• Isotype: IgG