Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATXN7L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ATXN7L1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ATXN7L1 Polyclonal specifically detects ATXN7L1 in Human samples. It is validated for Western Blot.Specifications
ATXN7L1 | |
Polyclonal | |
Rabbit | |
A4D0Q2 | |
222255 | |
Synthetic peptides corresponding to ATXN7L1(ataxin 7-like 1) The peptide sequence was selected from the middle region of ATXN7L1. Peptide sequence KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ataxin 7-like 1, ataxin 7-like 4, ataxin-7-like protein 1, Ataxin-7-like protein 4, ATXN7L4, FLJ40255, FLJ58242, KIAA1218MGC10760, MGC33190 | |
ATXN7L1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title