Aurora B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP255144	Novus Biologicals NBP255144	100 μL
NB395149	Novus Biologicals NBP25514425UL	25 μL

Description

Aurora B Polyclonal specifically detects Aurora B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Aurora B
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, DNA Repair, Mitotic Regulators, Stem Cell Markers
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 9212
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: AIK2EC 2.7.11.1, AIM1Aik2, AIM-1STK-1, ARK2ARK-2, AurB, aurkb-sv2, Aurora- and IPL1-like midbody-associated protein 1, aurora kinase BSerine/threonine-protein kinase aurora-B, aurora kinase B-Sv1, aurora kinase B-Sv2, Aurora/IPL1-related kinase 2, aurora-1, aurora-B, Aurora-related kinase 2, EC 2.7.11, IPL1, serine/threonine kinase 12, serine/threonine-protein kinase 12, STK12aurkb-sv1, STK5
• Gene Symbols: AURKB
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only