Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aurora C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $501.50
Specifications
| Antigen | Aurora C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15499420
|
Novus Biologicals
NBP15499420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP154994
|
Novus Biologicals
NBP154994 |
100 μL |
Each for $501.50
|
|
|||||
Description
Aurora C Polyclonal specifically detects Aurora C in Human samples. It is validated for Western Blot.Specifications
| Aurora C | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| AIE2AIK3, ARK3Serine/threonine-protein kinase aurora-C, AurC, aurora kinase CAurora/IPL1/Eg2 protein 2, Aurora/IPL1-related kinase 3, aurora-C, Aurora-related kinase 3, EC 2.7.11, EC 2.7.11.1, serine/threonine kinase 13 (aurora/IPL1-like), serine/threonine-protein kinase 13, STK13ARK-3 | |
| AURKC | |
| IgG | |
| 34 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UQB9 | |
| 6795 | |
| Synthetic peptides corresponding to AURKC(aurora kinase C) The peptide sequence was selected from the middle region of AURKC. Peptide sequence TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title