Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AWAT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | AWAT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159865
|
Novus Biologicals
NBP159865 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
AWAT1 Polyclonal specifically detects AWAT1 in Human samples. It is validated for Western Blot.Specifications
| AWAT1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| acyl-CoA wax alcohol acyltransferase 1, DGA2, DGAT2L3, diacyl-glycerol acyltransferase 2, Diacylglycerol acyltransferase 2, diacylglycerol O-acyltransferase 2-like 3, Diacylglycerol O-acyltransferase 2-like protein 3, EC 2.3.1.75, Long-chain-alcohol O-fatty-acyltransferase 1 | |
| AWAT1 | |
| IgG | |
| Affinity Purified | |
| 38 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q58HT5 | |
| 158833 | |
| Synthetic peptides corresponding to AWAT1 (acyl-CoA wax alcohol acyltransferase 1) Antibody(against the N terminal of AWAT1. Peptide sequence NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title