B3GALNT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159448

Catalog No. NBP159448

Description

B3GALNT1 Polyclonal specifically detects B3GALNT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: B3GALNT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: b3Gal-T3, Beta-1,3-galactosyltransferase 3, Beta-1,3-GalNAc-T1, Beta-1,3-GalTase 3, beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group), Beta3GalT3, Beta3Gal-T3, beta-3-Gx-T3, brainiac1, EC 2.4.1.79, Galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase, Gb4Cer, GLCT3, Globoside synthase, globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase, P, P antigen synthase, P blood group globoside, polypeptide 3 (Globosideblood group), UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group), UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group), UDP-N-acetylgalactosamine:globotriaosylceramidebeta-1,3-N-acetylgalactosaminyltransferase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8706
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75752
• Gene Symbols: B3GALNT1
• Immunogen: Synthetic peptides corresponding to B3GALNT1(beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)) The peptide sequence was selected from the middle region of B3GALNT1. Peptide sequence PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Equine: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG