B3GNTL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB430123	Novus Biologicals NBP19083825UL	25 μL
NBP190838	Novus Biologicals NBP190838	0.1 mL

Description

B3GNTL1 Polyclonal specifically detects B3GNTL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: B3GNTL1
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: B3GNT8, beta-1,3-Gn-T8, beta-1,3-N-acetylglucosaminyltransferase 8, beta1,3-N-acetylglucosaminyltransferase-like protein 1, beta3Gn-T8, beta3GnTL1, beta3Gn-T-like protein 1, BGnT-8, BGnT-like protein 1, MGC126253, MGC126256, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 1, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1
• Gene Symbols: B3GNTL1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 146712
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only