Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
B4GALNT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16253520UL
Description
B4GALNT1 Polyclonal specifically detects B4GALNT1 in Human samples. It is validated for Western Blot.Specifications
B4GALNT1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q00973 | |
B4GALNT1 | |
Synthetic peptides corresponding to B4GALNT1(beta-1,4-N-acetyl-galactosaminyl transferase 1) The peptide sequence was selected from the N terminal of B4GALNT1. Peptide sequence APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG. | |
Affinity Purified | |
RUO | |
2583 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
(N-acetylneuraminyl)-galactosylglucosylceramide, beta-1,4 N-acetylgalactosaminyltransferase 1, beta1,4GalNAc-T, beta-1,4-N-acetyl-galactosaminyl transferase 1, beta1-4GalNAc-T, GALGTEC 2.4.1.92, GalNAc-T, GALNACT, GD2 synthase, GM2 synthase, GM2/GD2 synthase, SIAT2, UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1, UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramideN-acetylgalactosaminyltransferase (GalNAc-T) | |
Rabbit | |
59 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction