Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
B4GALNT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | B4GALNT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16253520
|
Novus Biologicals
NBP16253520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP162535
|
Novus Biologicals
NBP162535 |
100 μL |
Each for $487.50
|
|
|||||
Description
B4GALNT1 Polyclonal specifically detects B4GALNT1 in Human samples. It is validated for Western Blot.Specifications
| B4GALNT1 | |
| Polyclonal | |
| Rabbit | |
| Q00973 | |
| 2583 | |
| Synthetic peptides corresponding to B4GALNT1(beta-1,4-N-acetyl-galactosaminyl transferase 1) The peptide sequence was selected from the N terminal of B4GALNT1. Peptide sequence APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| (N-acetylneuraminyl)-galactosylglucosylceramide, beta-1,4 N-acetylgalactosaminyltransferase 1, beta1,4GalNAc-T, beta-1,4-N-acetyl-galactosaminyl transferase 1, beta1-4GalNAc-T, GALGTEC 2.4.1.92, GalNAc-T, GALNACT, GD2 synthase, GM2 synthase, GM2/GD2 synthase, SIAT2, UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1, UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramideN-acetylgalactosaminyltransferase (GalNAc-T) | |
| B4GALNT1 | |
| IgG | |
| 59 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title