B4GALT5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169018

Catalog No. NBP169018

Description

B4GALT5 Polyclonal specifically detects B4GALT5 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: B4GALT5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B4Gal-T5, beta-1,4-galactosyltransferase 5, Beta-1,4-GalT II, beta-1,4-GalT IV, Beta-1,4-GalTase 5, beta-1.4-galactosyltransferase V, beta4-GalT IV, Beta4Gal-T5, BETA4-GALT-IV, beta4GalT-V, EC 2.4.1.-, gt-V, MGC138470, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9JMK0
• Gene Symbols: B4GALT5
• Immunogen: Synthetic peptides corresponding to B4galt5 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5) The peptide sequence was selected from the C terminal of B4galt5. Peptide sequence GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9334
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.