Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. B4GALT5 Antibody, Novus Biologicals™

B4GALT5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16901820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16901820 20 μL
NBP169018 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16901820 Supplier Novus Biologicals Supplier No. NBP16901820UL

Description

Rabbit Polyclonal Antibody

B4GALT5 Polyclonal specifically detects B4GALT5 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen B4GALT5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9JMK0
Gene Alias B4Gal-T5, beta-1,4-galactosyltransferase 5, Beta-1,4-GalT II, beta-1,4-GalT IV, Beta-1,4-GalTase 5, beta-1.4-galactosyltransferase V, beta4-GalT IV, Beta4Gal-T5, BETA4-GALT-IV, beta4GalT-V, EC 2.4.1.-, gt-V, MGC138470, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5
Gene Symbols B4GALT5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to B4galt5 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5) The peptide sequence was selected from the C terminal of B4galt5. Peptide sequence GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDG
Molecular Weight of Antigen 45 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9334
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.