Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BAI2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP257224 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP257224 100 μL
NB403519 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP257224 Supplier Novus Biologicals Supplier No. NBP257224
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

BAI2 Polyclonal specifically detects BAI2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen BAI2
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias brain-specific angiogenesis inhibitor 2, Brain-specific angiongenesis inhibitor-2
Gene Symbols ADGRB2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Cancer, GPCR, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 576
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.