Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BAIAP2L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | BAIAP2L1 |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
BAIAP2L1 Polyclonal specifically detects BAIAP2L1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
BAIAP2L1 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
55971 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSEN | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
Polyclonal | |
Rabbit | |
Human, Mouse, Rat | |
BAI1-associated protein 2-like 1, BAI1-associated protein 2-like protein 1, brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1, FLJ42275, IRTKSInsulin receptor tyrosine kinase substrate | |
BAIAP2L1 | |
IgG | |
Affinity Purified | |
Specificity of human BIAP2L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title