BAP18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182670

Catalog No. NBP182670

Description

BAP18 Polyclonal specifically detects BAP18 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BAP18
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Alias: BAP18, BPTF-associated protein of 18 kDa, chromatin complexes subunit BAP18, chromosome 17 open reading frame 49, MGC49942, MLL1/MLL complex subunit C17orf49
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: C17ORF49
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFD
• Quantity: 0.1 mL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 124944
• Target Species: Human
• Isotype: IgG

For Research Use Only