Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BAT5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | BAT5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BAT5 Polyclonal specifically detects BAT5 in Human samples. It is validated for Western Blot.Specifications
BAT5 | |
Polyclonal | |
Rabbit | |
O95870 | |
7920 | |
Synthetic peptides corresponding to BAT5(HLA-B associated transcript 5) The peptide sequence was selected from the N terminal of BAT5. Peptide sequence VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
abhydrolase domain containing 16A, BAT5G5, D6S82EEC 3.-, HLA-B associated transcript 5, HLA-B-associated transcript 5, NG26protein BAT5, PP199, Protein G5 | |
ABHD16A | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title