Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BAT5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | BAT5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159990
|
Novus Biologicals
NBP159990 |
100 μL |
Each for $436.00
|
|
NBP15999020
|
Novus Biologicals
NBP15999020UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
BAT5 Polyclonal specifically detects BAT5 in Human samples. It is validated for Western Blot.Specifications
BAT5 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
abhydrolase domain containing 16A, BAT5G5, D6S82EEC 3.-, HLA-B associated transcript 5, HLA-B-associated transcript 5, NG26protein BAT5, PP199, Protein G5 | |
ABHD16A | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
O95870 | |
7920 | |
Synthetic peptides corresponding to BAT5(HLA-B associated transcript 5) The peptide sequence was selected from the N terminal of BAT5. Peptide sequence VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title