Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BAT5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen BAT5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159990
View Documents
Novus Biologicals
NBP159990
100 μL
Each for $436.00
Add to cart
 
NBP15999020
View Documents
Novus Biologicals
NBP15999020UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

BAT5 Polyclonal specifically detects BAT5 in Human samples. It is validated for Western Blot.
Specifications

Specifications

BAT5
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
abhydrolase domain containing 16A, BAT5G5, D6S82EEC 3.-, HLA-B associated transcript 5, HLA-B-associated transcript 5, NG26protein BAT5, PP199, Protein G5
ABHD16A
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
O95870
7920
Synthetic peptides corresponding to BAT5(HLA-B associated transcript 5) The peptide sequence was selected from the N terminal of BAT5. Peptide sequence VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit