Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BBS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17968420UL
Description
BBS1 Polyclonal specifically detects BBS1 in Mouse samples. It is validated for Western Blot.Specifications
BBS1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001028300 | |
BBS1 | |
Synthetic peptide directed towards the N terminal of human Bbs1The immunogen for this antibody is Bbs1. Peptide sequence PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI. | |
Affinity Purified | |
RUO | |
582 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Bardet-Biedl syndrome 1, Bardet-Biedl syndrome 1 protein, BBS2L2, BBS2-like protein 2, FLJ23590, MGC126183, MGC126184, MGC51114 | |
Rabbit | |
65 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction