Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BBS10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16899320UL
Description
BBS10 Polyclonal specifically detects BBS10 in Human samples. It is validated for Western Blot.Specifications
BBS10 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8TAM1 | |
BBS10 | |
Synthetic peptides corresponding to BBS10 (Bardet-Biedl syndrome 10) The peptide sequence was selected from the C terminal of BBS10. Peptide sequence SQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Bardet-Biedl syndrome 10, Bardet-Biedl syndrome 10 protein, FLJ23560C12orf58chromosome 12 open reading frame 58 | |
Rabbit | |
81 kDa | |
20 μL | |
Vision | |
79738 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction