Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BBS10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | BBS10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16899320
|
Novus Biologicals
NBP16899320UL |
20 μL |
Each for $152.22
|
|
NBP168993
|
Novus Biologicals
NBP168993 |
100 μL |
Each for $436.00
|
|
Description
BBS10 Polyclonal specifically detects BBS10 in Human samples. It is validated for Western Blot.Specifications
| BBS10 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| Q8TAM1 | |
| 79738 | |
| Synthetic peptides corresponding to BBS10 (Bardet-Biedl syndrome 10) The peptide sequence was selected from the C terminal of BBS10. Peptide sequence SQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Bardet-Biedl syndrome 10, Bardet-Biedl syndrome 10 protein, FLJ23560C12orf58chromosome 12 open reading frame 58 | |
| BBS10 | |
| IgG | |
| Affinity Purified | |
| 81 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title