Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BBS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | BBS2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BBS2 Polyclonal specifically detects BBS2 in Human samples. It is validated for Western Blot.Specifications
BBS2 | |
Polyclonal | |
Rabbit | |
Vision | |
583 | |
Synthetic peptides corresponding to BBS2 (Bardet-Biedl syndrome 2) The peptide sequence was selected from the N terminal of BBS2. Peptide sequence GSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Bardet-Biedl syndrome 2, Bardet-Biedl syndrome 2 protein, BBS, MGC20703 | |
BBS2 | |
IgG | |
80 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title