Invitrogen™ BCAR3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578858

Catalog No. PIPA578858

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HEPG2 whole cell. IHC: mouse lymphaden tissue, rat spleen tissue, human tonsil tissue.

Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48.

Specifications

• Antigen: BCAR3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: BCAR3
• Gene Alias: AI131758; And34; AND-34; Bcar3; breast cancer anti-estrogen resistance 3; breast cancer antiestrogen resistance 3 protein; breast cancer anti-estrogen resistance protein 3; dJ1033H22.2 (breast cancer anti-estrogen resistance 3); KIAA0554; novel SH2-containing protein 2; NSP2; OTTHUMP00000011961; p130Cas-binding protein AND-34; SH2 domain-containing protein 3B; SH2D3B; UNQ271/PRO308
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 29815, 310838, 8412
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O75815, Q9QZK2
• Gene Symbols: BCAR3
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG