BCAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169020

Catalog No. NBP169020

Description

BCAT1 Polyclonal specifically detects BCAT1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: BCAT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BCAT(c), BCATC, BCT1PNAS121, branched chain amino-acid transaminase 1, cytosolic, branched chain aminotransferase 1, cytosolic, branched-chain-amino-acid aminotransferase, cytosolic, DKFZp686E12175, EC 2.6.1.42, ECA39, MECA39, placental protein 18, PP18, Protein ECA39
• Host Species: Rabbit
• Molecular Weight of Antigen: 50 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8CBC8
• Gene Symbols: BCAT1
• Immunogen: Synthetic peptides corresponding to Bcat1 (branched chain aminotransferase 1, cytosolic) The peptide sequence was selected from the C terminal of Bcat1. Peptide sequence ACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTI The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 586
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG