Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. BCAT1 Antibody, Novus Biologicals™

BCAT1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16902020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16902020 20 μL
NBP169020 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16902020 Supplier Novus Biologicals Supplier No. NBP16902020UL

Description

Rabbit Polyclonal Antibody

BCAT1 Polyclonal specifically detects BCAT1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen BCAT1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8CBC8
Gene Alias BCAT(c), BCATC, BCT1PNAS121, branched chain amino-acid transaminase 1, cytosolic, branched chain aminotransferase 1, cytosolic, branched-chain-amino-acid aminotransferase, cytosolic, DKFZp686E12175, EC 2.6.1.42, ECA39, MECA39, placental protein 18, PP18, Protein ECA39
Gene Symbols BCAT1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Bcat1 (branched chain aminotransferase 1, cytosolic) The peptide sequence was selected from the C terminal of Bcat1. Peptide sequence ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI.
Molecular Weight of Antigen 50 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 586
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.