Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BCAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16902020UL
Description
BCAT1 Polyclonal specifically detects BCAT1 in Mouse samples. It is validated for Western Blot.Specifications
BCAT1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8CBC8 | |
BCAT1 | |
Synthetic peptides corresponding to Bcat1 (branched chain aminotransferase 1, cytosolic) The peptide sequence was selected from the C terminal of Bcat1. Peptide sequence ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI. | |
Affinity Purified | |
RUO | |
586 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
BCAT(c), BCATC, BCT1PNAS121, branched chain amino-acid transaminase 1, cytosolic, branched chain aminotransferase 1, cytosolic, branched-chain-amino-acid aminotransferase, cytosolic, DKFZp686E12175, EC 2.6.1.42, ECA39, MECA39, placental protein 18, PP18, Protein ECA39 | |
Rabbit | |
50 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction