BCKDHA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NBP179616

Catalog No. NBP179616

Description

BCKDHA Polyclonal specifically detects BCKDHA in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BCKDHA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial, BCKDE1A, BCKDH E1-alpha, branched chain keto acid dehydrogenase E1, alpha polypeptide, branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urinedisease), Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain, EC 1.2.4.4,2-oxoisovalerate dehydrogenase (lipoamide), FLJ45695, MSU, MSUD1, OVD1A
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 593
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: NP_000700
• Gene Symbols: BCKDHA
• Immunogen: Synthetic peptide directed towards the N terminal of human BCKDHAThe immunogen for this antibody is BCKDHA. Peptide sequence NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only