Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BCKDHB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317345100UL
This item is not returnable.
View return policy
Description
BCKDHB Polyclonal antibody specifically detects BCKDHB in Human samples. It is validated for ImmunofluorescenceSpecifications
| BCKDHB | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| 2-oxoisovalerate dehydrogenase beta subunit, 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, BCKDE1B, BCKDH E1-beta, branched chain alpha-ketoacid dehydrogenase E1-beta subunit, branched chain keto acid dehydrogenase E1, beta polypeptide, Branched-chain alpha-keto acid dehydrogenase E1 component beta chain, dJ279A18.1, E1B, E1b-beta subunit of the branched-chain complex, EC 1.2.4.4, FLJ17880 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDAL | |
| 100 μg | |
| Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Signal Transduction | |
| 594 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction