Novus Biologicals™ Bcl-6 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bcl-6

Source: E.coli

Amino Acid Sequence:

EHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVR

Specifications

• Gene ID (Entrez): 604
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Antibody Competition
• Gene Alias: B-cell CLL/lymphoma 6, B-cell lymphoma 6 protein transcript, BCL-5, BCL5B-cell lymphoma 5 protein, BCL-6, BCL6A, cys-his2 zinc finger transcription factor, LAZ3ZBTB27B-cell lymphoma 6 protein, lymphoma-associated zinc finger gene on chromosome 3, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51ZNF51, zinc finger transcription factor BCL6S
• Gene Symbol: BCL6
• Molecular Weight (g/mol): 29 kDa
• Quantity: 100 μL
• Source: E. coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55064. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Storage Buffer: PBS and 1M Urea, pH 7.4.