Learn More
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bcl-6
Source: E.coli
Amino Acid Sequence:
EHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVR
Specifications
Specifications
| Gene ID (Entrez) | 604 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Antibody Competition |
| Gene Alias | B-cell CLL/lymphoma 6, B-cell lymphoma 6 protein transcript, BCL-5, BCL5B-cell lymphoma 5 protein, BCL-6, BCL6A, cys-his2 zinc finger transcription factor, LAZ3ZBTB27B-cell lymphoma 6 protein, lymphoma-associated zinc finger gene on chromosome 3, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51ZNF51, zinc finger transcription factor BCL6S |
| Gene Symbol | BCL6 |
| Molecular Weight (g/mol) | 29 kDa |
| Quantity | 100 μL |
| Source | E. coli |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
