Invitrogen™ Bcl-X Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595348

Catalog No. PIPA595348

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: SW620 whole cell. Flow: PC-3 cell, A549 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The protein encoded the BCL-X gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator.

Specifications

• Antigen: Bcl-X
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: BCL2L1
• Gene Alias: anti-apoptosis regulatory protein; anti-apoptotic Bcl-2 gene family member; anti-apoptotic Bcl-xL; anti-apoptotic regulator Bcl-xL; apoptosis regulator Bcl-X; B cell lymphoma 2 like; B cell lymphoma like X; B-cell leukemia/lymphoma x; Bcl 2 like 1; bcl x; Bcl xL; BCL XL/S; Bcl(X)L; bcl-2 L1; BCL2 like 1; BCL2L; Bcl2l1; bcl2-L-1; BCL2-like 1; Bcl-2-like protein 1; BCL2-like protein 1; BCLX; bcl-x; Bcl-x long protein; BclxL; Bcl-xL; BCL-XL/S; BclXS; bcl-xS; BLC2L; DKFZp781P2092; PPP1R52; protein phosphatase 1, regulatory subunit 52; RP5-857M17.3; unnamed protein product
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 598
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q07817
• Gene Symbols: BCL2L1
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG