Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BCL9-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25506025UL
Description
BCL9-2 Polyclonal specifically detects BCL9-2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
BCL9-2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
B-cell CLL/lymphoma 9-like, B-cell CLL/lymphoma 9-like protein, B-cell lymphoma 9-like protein, BCL9-like protein, DLNB11BCL9-2, nuclear co-factor of beta-catenin signalling, Protein BCL9-2 | |
Rabbit | |
Affinity Purified | |
RUO | |
283149 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
BCL9L | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MGMEFGGGRGLLSPPMGQSGLREVDPPMGPGNLNMNMNVNMNMNMNLNVQMTPQQQMLMSQKMRGPGDLMGPQGLSPEEMARVRAQNSSGVMGGPQKMLMP | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction