Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BCMO1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | BCMO1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
BCMO1 Polyclonal specifically detects BCMO1 in Human samples. It is validated for Western Blot.Specifications
| BCMO1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS buffer, 2% sucrose | |
| 53630 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BCDO1, BCDOEC 1.14.99.36, BCMO, BCO, BCO1, beta, beta-carotene 15, 15'-dioxygenase 1, beta-carotene 15,15'-monooxygenase, beta-carotene 15,15'-monooxygenase 1, Beta-carotene dioxygenase 1, FLJ10730 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human BCMO1. Peptide sequence GNVLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSR | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title