Novus Biologicals™ BCOR Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCOR. Source: E.coli Amino Acid Sequence: NINGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTNGERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVDSHAYPHIQNSKQPRV The BCOR Recombinant Protein Antigen is derived from E. coli. The BCOR Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 54880
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: BCOR Recombinant Protein Antigen
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: ANOP2, BCL6 corepressor, BCL-6 corepressor, BCL6 co-repressor, BCL-6 interacting corepressor, BCoR, FLJ20285, FLJ38041, KIAA1575MGC71031, MAA2, MCOPS2, MGC131961
• Gene Symbol: BCOR
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52085. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only