BDNF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP159304

Catalog No. NBP159304

Description

BDNF Polyclonal specifically detects BDNF in Human, Mouse, Monkey, Rhesus Macaque samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BDNF
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: abrineurin, brain-derived neurotrophic factor, MGC34632, neurotrophin
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:200- 1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
• Gene Accession No.: P23560
• Gene Symbols: BDNF
• Immunogen: Synthetic peptides corresponding to BDNF(brain-derived neurotrophic factor) The peptide sequence was selected from the middle region of BDNF. Peptide sequence EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG.
• Quantity: 100 μL
• Research Discipline: Cytokine Research, Immunology, Neuroscience
• Gene ID (Entrez): 627
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine, Monkey, Rabbit
• Isotype: IgG

For Research Use Only