Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Bend6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP17422820UL

View more versions of this product

Catalog No. NBP17422820

$206.00 / Each of 1

Qty

Add to Cart

Description

Bend6 Polyclonal specifically detects Bend6 in Rat samples. It is validated for Western Blot.

Specifications

Antigen	Bend6
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000
Gene Alias	BEN domain-containing protein 6, bA203B9.1, BEN domain containing 6, C6orf65
Host Species	Rabbit
Molecular Weight of Antigen	31 kDa
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Rat
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Symbols	BEND6
Immunogen	Synthetic peptides corresponding to the C terminal of Bend6. Immunizing peptide sequence FINDLMQVLYTNEYMATHSLTGAKSSTSRDKVVKPAMNQNEVQEIIGILK.
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	221336
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

Bend6 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions