Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Bend6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | Bend6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17422820
![]() |
Novus Biologicals
NBP17422820UL |
20 μL |
Each for $206.00
|
|
|||||
NBP174228
![]() |
Novus Biologicals
NBP174228 |
100 μL |
Each for $487.50
|
|
|||||
Description
Bend6 Polyclonal specifically detects Bend6 in Rat samples. It is validated for Western Blot.Specifications
Bend6 | |
Polyclonal | |
Rabbit | |
BEN domain-containing protein 6, bA203B9.1, BEN domain containing 6, C6orf65 | |
BEND6 | |
IgG | |
31 kDa |
Western Blot | |
Unconjugated | |
RUO | |
221336 | |
Synthetic peptides corresponding to the C terminal of Bend6. Immunizing peptide sequence FINDLMQVLYTNEYMATHSLTGAKSSTSRDKVVKPAMNQNEVQEIIGILK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title