Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BET1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | BET1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
BET1 Polyclonal specifically detects BET1 in Human samples. It is validated for Western Blot.Specifications
BET1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
Bet1 (S. cerevisiae) homolog, BET1 homolog, BET1 homolog (S. cerevisiae), Bet1p homolog, blocked early in transport 1 homolog (S. cerevisiae), DKFZp781C0425, Golgi vesicular membrane trafficking protein p18, Golgi vesicular membrane-trafficking protein p18, HBET1 | |
The immunogen is a synthetic peptide directed towards the middle terminal region of human BET1 (NP_005859.1). Peptide sequence IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYM | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
10282 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title