beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP321368100UL

Catalog No. NB238256

Description

beta-1,3-Glucuronyltransferase 1/B3GAT1 Polyclonal antibody specifically detects beta-1,3-Glucuronyltransferase 1/B3GAT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: beta-1,3-Glucuronyltransferase 1/B3GAT1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Beta-1,3-glucuronyltransferase 1, beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P), EC 2.4.1.135, galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1, GlcAT-P, GLCATPGLCUATP, glcUAT-P, Glucuronosyltransferase P, NK1, NK-1, UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN
• Quantity: 100 μg
• Research Discipline: Cancer, Immunology
• Gene ID (Entrez): 27087
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified