Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310595100UL
Description
Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Polyclonal specifically detects Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 in Mouse samples. It is validated for Western Blot.Specifications
Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
B3GN-T1, beta-1,3-N-acetylglucosaminyltransferase bGnT-6, BETA3GNTI, EC 2.4.1.149, i-beta-1,3-N-acetylglucosaminyltransferase, iGAT, IGNT, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase, Poly-N-acetyllactosamine extension enzyme, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 | |
The immunogen is a synthetic peptide directed towards the middle region of Mouse B3gnt1 (NP_780592). Peptide sequence RYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNL | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
11041 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction