Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB126091 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB126091 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB126091 Supplier Novus Biologicals Supplier No. NBP310595100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Polyclonal specifically detects Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias B3GN-T1, beta-1,3-N-acetylglucosaminyltransferase bGnT-6, BETA3GNTI, EC 2.4.1.149, i-beta-1,3-N-acetylglucosaminyltransferase, iGAT, IGNT, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase, Poly-N-acetyllactosamine extension enzyme, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Mouse B3gnt1 (NP_780592). Peptide sequence RYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNL
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11041
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.