Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | beta-1,4-Galactosyltransferase 1/B4GalT1 |
---|---|
Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
beta-1,4-Galactosyltransferase 1/B4GalT1 Polyclonal specifically detects beta-1,4-Galactosyltransferase 1/B4GalT1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
beta-1,4-Galactosyltransferase 1/B4GalT1 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
1,4- galactosyltransferase, polypeptide 1, B4GAL-T1, beta-1,4-galactosyltransferase 1, Beta-1,4-GalTase 1, Beta4Gal-T1, betaGlcNAc beta, CDG2D, EC 2.4.1, GGTB2DKFZp686N19253, glycoprotein-4-beta-galactosyltransferase 2, GT1, GTB, lactose synthase, MGC50983, UDP-Gal, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1 | |
B4GALT1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
2683 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title