beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15983720UL

Catalog No. NBP15983720

Description

beta-1,4-Galactosyltransferase 2/B4GalT2 Polyclonal specifically detects beta-1,4-Galactosyltransferase 2/B4GalT2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: beta-1,4-Galactosyltransferase 2/B4GalT2
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Accession No.: O60909
• Gene Symbols: B4GALT2
• Immunogen: Synthetic peptides corresponding to B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2) The peptide sequence was selected from the middle region of B4GALT2. Peptide sequence AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISL
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B4Gal-T2, B4Gal-T3, beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2, beta-4-GalT2, beta4Gal-T2, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 20 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 8704
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.