Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | beta-1,4-Galactosyltransferase 2/B4GalT2 |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
beta-1,4-Galactosyltransferase 2/B4GalT2 Polyclonal specifically detects beta-1,4-Galactosyltransferase 2/B4GalT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
beta-1,4-Galactosyltransferase 2/B4GalT2 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
B4Gal-T2, B4Gal-T3, beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2, beta-4-GalT2, beta4Gal-T2, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2 | |
B4GALT2 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
8704 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: LPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title