beta-Catenin Antibody (CL3691), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP261629

Catalog No. NBP261629

Description

beta-Catenin Monoclonal specifically detects beta-Catenin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: beta-Catenin
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CTNNB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Clone: CL3691
• Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:10000 - 1:20000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:10000 - 1:20000
• Gene Alias: beta 1 (88kD), beta-catenin, catenin (cadherin-associated protein), beta 1, 88kDa, catenin beta-1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923
• Host Species: Mouse
• Purification Method: Protein A purified
• Research Discipline: Cancer, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix, Immune System Diseases, Mucosal Immunology, Neuroscience, Signal Transduction, Stem Cell Signaling Pathway, Wnt Signaling Pathway
• Gene ID (Entrez): 1499
• Target Species: Human
• Form: Purified