Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
beta-Defensin 4/2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17979220UL
Description
beta-Defensin 4/2 Polyclonal specifically detects beta-Defensin 4/2 in Human samples. It is validated for Western Blot.Specifications
beta-Defensin 4/2 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_004933 | |
DEFB4A | |
Synthetic peptide directed towards the N terminal of human DEFB4AThe immunogen for this antibody is DEFB4A. Peptide sequence LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL. | |
Affinity Purified | |
RUO | |
1673 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Beta-defensin 2, DEFB-2, DEFB2DEFB102, DEFB4beta-defensin 4A, Defensin, beta 2Skin-antimicrobial peptide 1, defensin, beta 4, defensin, beta 4A, HBD-2, SAP1BD-2 | |
Rabbit | |
4 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction