Beta Ig-h3/TGFBI Rabbit anti-Human, Mouse, Rat, Clone: 7Q5O9, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP31599420UL

Catalog No. NB167084

Description

Beta Ig-h3/TGFBI Monoclonal antibody specifically detects Beta Ig-h3/TGFBI in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Beta Ig-h3/TGFBI
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: 7Q5O9
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: Beta ig-h3, BIGH3EBMD, CDB1, CDG2, CDGG1transforming growth factor, beta-induced, 68kD, CSD, CSD1, CSD2, CSD3, Kerato-epithelin, LCD1, RGD-CAP, RGD-containing collagen-associated protein, transforming growth factor, beta-induced, 68kDa, transforming growth factor-beta-induced protein ig-h3
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Beta Ig-h3/TGFBI (Q15582). AVQKVIGTNRKYFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTIFAPSNEAWAS
• Quantity: 20 μg
• Research Discipline: Angiogenesis, Cytokine Research, Immunology, Vision
• Gene ID (Entrez): 7045
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG