beta-Synuclein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP19034225UL

Catalog No. NB430385

Description

beta-Synuclein Polyclonal specifically detects beta-Synuclein in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: beta-Synuclein
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: beta-synuclein, synuclein, beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human beta-Synuclein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SNCB
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
• Quantity: 25 μL
• Research Discipline: Alzheimers Research, Neuroscience
• Gene ID (Entrez): 6620
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only